Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NMDAR2B Antibody (Phospho-Tyr1474)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Glutamate ionotropic receptor NMDA type subunit 2B

Gene Aliases

DEE27; EIEE27; GluN2B; GluN2B (alt_5'UTR) ; glutamate [NMDA] receptor subunit epsilon-2; glutamate receptor ionotropic, NMDA 2B; glutamate receptor subunit epsilon-2; glutamate receptor, ionotropic, N-methyl D-aspartate 2B; hNR3; MRD6; NMDAR2B; N-methyl D-aspartate receptor subtype 2B; N-methyl-D-aspartate receptor subunit 3; NR2B; NR3.

Gene ID

2904

Swiss Prot

Q13224

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human NMDAR2B around the phosphorylation site of Tyr1474.

Target

Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg (2+) (PubMed:8768735, PubMed:26919761, PubMed:26875626, PubMed:28126851) . Sensitivity to glutamate and channel kinetics depend on the subunit composition (PubMed:8768735, PubMed:26875626) . In concert with DAPK1 at extrasynaptic sites, acts as a central mediator for stroke damage. Its phosphorylation at Ser-1303 by DAPK1 enhances synaptic NMDA receptor channel activity inducing injurious Ca2+ influx through them, resulting in an irreversible neuronal death. Contributes to neural pattern formation in the developing brain. Plays a role in long-term depression (LTD) of hippocampus membrane currents and in synaptic plasticity (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HGAVPARFQKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

165 kDa

Notes

Formerly GWB-ASB184

Specificity

NMDAR2B (Phospho-Tyr1474) Antibody detects endogenous levels of NMDAR2B only when phosphorylated at Tyr1474.

NCBI Gene Symbol

GRIN2B

Host or Source

Rabbit

Protein Name

Glutamate receptor ionotropic, NMDA 2B

Gene Name URL

GRIN2B

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-ACTR1A Antibody
DL98048A-01 50 µL

Rabbit anti-ACTR1A Antibody

Sign In for Pricing
View Details
Rabbit anti-ACTR1A Antibody
DL98048A-02 100 µL

Rabbit anti-ACTR1A Antibody

Sign In for Pricing
View Details
TMEM102 AAV Vector (Mouse) (CMV)
46855104 1 µg

TMEM102 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
14-3-3 epsilon Antibody / YWHAE
orb606854-01 20 µg

14-3-3 epsilon Antibody / YWHAE

Sign In for Pricing
View Details
14-3-3 epsilon Antibody / YWHAE
orb606854-02 100 µg

14-3-3 epsilon Antibody / YWHAE

Sign In for Pricing
View Details
LEF-1 (phospho Ser42) Polyclonal Antibody
E44H00915 100 µL

LEF-1 (phospho Ser42) Polyclonal Antibody

Sign In for Pricing
View Details