Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEF2C Antibody (Phospho-Ser387)

Product Specifications

CAS Number

9007-83-4

Gene Name

Myocyte enhancer factor 2C

Gene Aliases

C5DELq14.3; DEL5q14.3; MADS box transcription enhancer factor 2, polypeptide C; Myocyte enhancer factor 2C; myocyte-specific enhancer factor 2C; NEDHSIL.

Gene ID

4208

Swiss Prot

Q06413

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human MEF2C around the phosphorylation site of Ser387.

Target

Transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B-lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B-cells. May also be involved in neurogenesis and in the development of cortical architecture (By similarity) . Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isoform 2.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QHLHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRT

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

51 kDa

Notes

Formerly GWB-ASB172

Specificity

MEF2C (Phospho-Ser387) Antibody detects endogenous levels of MEF2C only when phosphorylated at Ser387.

NCBI Gene Symbol

MEF2C

Host or Source

Rabbit

Protein Name

Myocyte-specific enhancer factor 2C

Gene Name URL

MEF2C

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Immunoglobulin Superfamily Member 2 (IGSF2) Antibody
abx234191 100 µg

Immunoglobulin Superfamily Member 2 (IGSF2) Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal CD19 Antibody (JF100-06)
NBP2-67229 100 µL

Rabbit Monoclonal CD19 Antibody (JF100-06)

Sign In for Pricing
View Details
Anti-MBTD1 Antibody
CTA4467-01 30 µL

Anti-MBTD1 Antibody

Sign In for Pricing
View Details
Anti-MBTD1 Antibody
CTA4467-02 50 μL

Anti-MBTD1 Antibody

Sign In for Pricing
View Details
Anti-MBTD1 Antibody
CTA4467-03 100 µL

Anti-MBTD1 Antibody

Sign In for Pricing
View Details
Anti-MBTD1 Antibody
CTA4467-04 200 µL

Anti-MBTD1 Antibody

Sign In for Pricing
View Details