Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERF Antibody (Phospho-Thr526)

Product Specifications

CAS Number

9007-83-4

Gene Name

ETS2 repressor factor

Gene Aliases

CHYTS; CRS4; ETS domain-containing transcription factor ERF; Ets2 repressor factor; PE2; PE-2.

Gene ID

2077

Swiss Prot

P50548

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human ERF around the phosphorylation site of Thr526.

Target

Potent transcriptional repressor that binds to the H1 element of the Ets2 promoter. May regulate other genes involved in cellular proliferation. Required for extraembryonic ectoderm differentiation, ectoplacental cone cavity closure, and chorioallantoic attachment (By similarity) . May be important for regulating trophoblast stem cell differentiation (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

CRLEGGGGPAGGFEDEGEDKKVRGEGPGEAGGPLTPRRVSSDLQHATAQL

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

58 kDa

Notes

Formerly GWB-ASB145

Specificity

ERF (Phospho-Thr526) Antibody detects endogenous levels of ERF only when phosphorylated at Thr526.

NCBI Gene Symbol

ERF

Host or Source

Rabbit

Protein Name

ETS domain-containing transcription factor ERF

Gene Name URL

ERF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse B-Cell Leukemia/Lymphoma 2 (BCL2) ELISA Kit
abx574406 96 Well

Mouse B-Cell Leukemia/Lymphoma 2 (BCL2) ELISA Kit

Sign In for Pricing
View Details
ATG10 Conjugated Antibody
C36115 100 µL

ATG10 Conjugated Antibody

Sign In for Pricing
View Details
ACVR1B, ID (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (MaxLight 405)
MBS6461328-01 0.1 mL

ACVR1B, ID (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (MaxLight 405)

Sign In for Pricing
View Details
ACVR1B, ID (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (MaxLight 405)
MBS6461328-02 5x 0.1 mL

ACVR1B, ID (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (MaxLight 405)

Sign In for Pricing
View Details
Axin Double Nickase Plasmid (h2)
sc-401074-NIC-2 20 µg

Axin Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
CARD12 Overexpression Lysate (Native) - (Dry Ice)
NBP2-06545 0.1 mg

CARD12 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details