Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Artemis Antibody (Phospho-Ser516)

Product Specifications

CAS Number

9007-83-4

Gene Name

DNA cross-link repair 1C

Gene Aliases

A-SCID; DCLREC1C; DNA cross-link repair 1C (PSO2 homolog, S. cerevisiae) ; DNA cross-link repair 1C protein; protein artemis; Protein A-SCID; RS-SCID; SCIDA; severe combined immunodeficiency, type a (Athabascan) ; SNM1 homolog C; SNM1C; SNM1-like protein.

Gene ID

64421

Swiss Prot

Q96SD1

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human Artemis around the phosphorylation site of Ser516.

Target

Required for V (D) J recombination, the process by which exons encoding the antigen-binding domains of immunoglobulins and T-cell receptor proteins are assembled from individual V, (D), and J gene segments. V (D) J recombination is initiated by the lymphoid specific RAG endonuclease complex, which generates site specific DNA double strand breaks (DSBs) . These DSBs present two types of DNA end structures: hairpin sealed coding ends and phosphorylated blunt signal ends. These ends are independently repaired by the non homologous end joining (NHEJ) pathway to form coding and signal joints respectively. This protein exhibits single-strand specific 5'-3' exonuclease activity in isolation and acquires endonucleolytic activity on 5' and 3' hairpins and overhangs when in a complex with PRKDC. The latter activity is required specifically for the resolution of closed hairpins prior to the formation of the coding joint. May also be required for the repair of complex DSBs induced by ionizing radiation, which require substantial end-processing prior to religation by NHEJ.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ADGDVPQWEVFFKRNDEITDESLENFPSSTVAGGSQSPKLFSDSDGESTH

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

78 kDa

Notes

Formerly GWB-ASB129

Specificity

Artemis (Phospho-Ser516) Antibody detects endogenous levels of Artemis only when phosphorylated at Ser516.

NCBI Gene Symbol

DCLRE1C

Host or Source

Rabbit

Protein Name

Protein artemis

Gene Name URL

DCLRE1C

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pseudomonas aeruginosa, serotype 2B discontinued
P9175-01C 200 µg

Pseudomonas aeruginosa, serotype 2B discontinued

Sign In for Pricing
View Details
CITED2 Protein Vector (Human) (pPB-C-His)
PV069661 500 ng

CITED2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ACHE sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0028906 1.0 µg DNA

ACHE sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Histone H4 (MonoMethyl-K20) Mouse Monoclonal Antibody
orb2988339-01 30 µL

Histone H4 (MonoMethyl-K20) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Histone H4 (MonoMethyl-K20) Mouse Monoclonal Antibody
orb2988339-02 50 µL

Histone H4 (MonoMethyl-K20) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Histone H4 (MonoMethyl-K20) Mouse Monoclonal Antibody
orb2988339-03 100 µL

Histone H4 (MonoMethyl-K20) Mouse Monoclonal Antibody

Sign In for Pricing
View Details