Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ku70 Antibody (Phospho-Ser5)

Product Specifications

CAS Number

9007-83-4

Gene Name

X-ray repair cross complementing 6

Gene Aliases

5'-deoxyribose-5-phosphate lyase Ku70;5'-dRP lyase Ku70;70 kDa subunit of Ku antigen; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; ATP-dependent DNA helicase II, 70 kDa subunit; CTC box binding factor 75 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; CTCBF; DNA repair protein XRCC6; G22P1; Ku autoantigen p70 subunit; Ku autoantigen, 70kDa; KU70; lupus Ku autoantigen protein p70; ML8; thyroid autoantigen 70kD (Ku antigen) ; thyroid autoantigen 70kDa (Ku antigen) ; Thyroid-lupus autoantigen; thyroid-lupus autoantigen p70; TLAA; X-ray repair complementing defective repair in Chinese hamster cells 6; X-ray repair cross-complementing protein 6.

Gene ID

2547

Swiss Prot

P12956

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human Ku70 around the phosphorylation site of Ser5.

Target

Single-stranded DNA-dependent ATP-dependent helicase. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by XRCC6. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V (D) J recombination. The XRCC5/6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5/6 dimer is probably involved in stabilizing broken DNA ends and bringing them together. The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. Required for osteocalcin gene expression. Probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks. 5'-dRP lyase activity allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5/6 dimer together with APEX1 acts as a negative regulator of transcription. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

69 kDa

Notes

Formerly GWB-ASB124

Specificity

Ku70 (Phospho-Ser5) Antibody detects endogenous levels of Ku70 only when phosphorylated at Ser5.

NCBI Gene Symbol

XRCC6

Host or Source

Rabbit

Protein Name

X-ray repair cross-complementing protein 6

Gene Name URL

XRCC6

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Protein disulfide-isomerase
MBS718912-01 0.02 mg (E-Coli)

Recombinant Human Protein disulfide-isomerase

Sign In for Pricing
View Details
Recombinant Human Protein disulfide-isomerase
MBS718912-02 0.02 mg (Yeast)

Recombinant Human Protein disulfide-isomerase

Sign In for Pricing
View Details
Recombinant Human Protein disulfide-isomerase
MBS718912-03 0.1 mg (E-Coli)

Recombinant Human Protein disulfide-isomerase

Sign In for Pricing
View Details
Recombinant Human Protein disulfide-isomerase
MBS718912-04 0.1 mg (Yeast)

Recombinant Human Protein disulfide-isomerase

Sign In for Pricing
View Details
Recombinant Human Protein disulfide-isomerase
MBS718912-05 1 mg (E-Coli)

Recombinant Human Protein disulfide-isomerase

Sign In for Pricing
View Details
Recombinant Human Protein disulfide-isomerase
MBS718912-06 1 mg (Yeast)

Recombinant Human Protein disulfide-isomerase

Sign In for Pricing
View Details