What is the catalog number for AMPK beta1 Antibody (Phospho-Ser181)?

The catalog number for AMPK beta1 Antibody (Phospho-Ser181) is OAAF07344-100UG.

What sizes are available for AMPK beta1 Antibody (Phospho-Ser181)?

AMPK beta1 Antibody (Phospho-Ser181) is available in the following size(s): 100 µg.

Is AMPK beta1 Antibody (Phospho-Ser181) in stock?

AMPK beta1 Antibody (Phospho-Ser181) is currently made to order / not held in immediate stock. Contact us for lead time.

AMPK beta1 Antibody (Phospho-Ser181)

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein kinase AMP-activated non-catalytic subunit beta 1

Gene Aliases

5'-AMP-activated protein kinase beta-1 subunit;5'-AMP-activated protein kinase subunit beta-1; AMP-activated protein kinase beta subunit; AMPK; AMPK beta 1; AMPK beta -1 chain; AMPK subunit beta-1; AMPKb; HAMPKb; protein kinase, AMP-activated, beta 1 non-catalytic subunit; protein kinase, AMP-activated, noncatalytic, beta-1.

Gene ID

5564

Swiss Prot

Q9Y478

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human AMPK beta1 around the phosphorylation site of Ser181.

Target

Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKP

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol