What is the catalog number for SHP-1 Antibody (Phospho-Tyr536)?

The catalog number for SHP-1 Antibody (Phospho-Tyr536) is OAAF07323-100UG.

What sizes are available for SHP-1 Antibody (Phospho-Tyr536)?

SHP-1 Antibody (Phospho-Tyr536) is available in the following size(s): 100 µg.

Is SHP-1 Antibody (Phospho-Tyr536) in stock?

SHP-1 Antibody (Phospho-Tyr536) is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

SHP-1 Antibody (Phospho-Tyr536)

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein tyrosine phosphatase non-receptor type 6

Gene Aliases

HCP; HCPH; hematopoietic cell phosphatase; hematopoietic cell protein-tyrosine phosphatase; HPTP1C; protein-tyrosine phosphatase 1C; protein-tyrosine phosphatase SHP-1; PTP-1C; SHP1; SHP-1; SHP-1L; SH-PTP1; tyrosine-protein phosphatase non-receptor type 6.

Gene ID

5777

Swiss Prot

P29350

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human SHP-1 around the phosphorylation site of Tyr536.

Target

Modulates signaling by tyrosine phosphorylated cell surface receptors such as KIT and the EGF receptor/EGFR. The SH2 regions may interact with other cellular components to modulate its own phosphatase activity against interacting substrates. Together with MTUS1, induces UBE2V2 expression upon angiotensin II stimulation. Plays a key role in hematopoiesis.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAK

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol