What is the catalog number for GABA-RB Antibody (Phospho-Ser434)?

The catalog number for GABA-RB Antibody (Phospho-Ser434) is OAAF07318-100UG.

What sizes are available for GABA-RB Antibody (Phospho-Ser434)?

GABA-RB Antibody (Phospho-Ser434) is available in the following size(s): 100 µg.

Is GABA-RB Antibody (Phospho-Ser434) in stock?

GABA-RB Antibody (Phospho-Ser434) is currently made to order / not held in immediate stock. Contact us for lead time.

GABA-RB Antibody (Phospho-Ser434)

Product Specifications

CAS Number

9007-83-4

Gene Name

Gamma-aminobutyric acid type A receptor subunit beta1

Gene Aliases

DEE45; EIEE45; GABA (A) receptor subunit beta-1; gamma-aminobutyric acid (GABA) A receptor, beta 1; gamma-aminobutyric acid receptor subunit beta-1; gamma-aminobutyric acid type A receptor beta1 subunit.

Gene ID

2560

Swiss Prot

P18505

Reactivity

Human|Monkey|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human GABA-RB around the phosphorylation site of Ser434.

Target

Component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the vertebrate brain. Functions also as histamine receptor and mediates cellular responses to histamine. Functions as receptor for diazepines and various anesthetics, such as pentobarbital; these are bound at a separate allosteric effector binding site. Functions as ligand-gated chloride channel.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SIQYRKPLSSREAYGRALDRHGVPSKGRIRRRASQLKVKIPDLTDVNSID

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol