Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-L2, Mouse (HEK293, His)

PD-L2 Protein plays a critical role in the T-cell costimulatory signal, fostering proliferation and IFNG production independently of PDCD1. While interacting with PDCD1 inhibits T-cell proliferation, PD-L2 itself intricately promotes immune responses. The dynamic interplay emphasizes PD-L2's dual role in either promoting or inhibiting T-cell activation within the immune signaling network, showcasing intricate regulatory mechanisms. PD-L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PD-L2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-l2-protein-mouse-219a-a-hek293-his.html

Purity

95.00

Smiles

LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR

Molecular Formula

58205 (Gene_ID) Q9WUL5 (L20-R219) (Accession)

Molecular Weight

31-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dysbindin (DTNBP1) (NM_032122) Human Over-expression Lysate
LY403167 100 µg

Dysbindin (DTNBP1) (NM_032122) Human Over-expression Lysate

Sign In for Pricing
View Details
HLA-E Antibody
KC-31053-01 50 μL

HLA-E Antibody

Sign In for Pricing
View Details
HLA-E Antibody
KC-31053-02 100 µL

HLA-E Antibody

Sign In for Pricing
View Details
HLA-E Antibody
KC-31053-03 1 mL

HLA-E Antibody

Sign In for Pricing
View Details
IFITM5 (NM_001025295) Human Over-expression Lysate
LY422431 100 µg

IFITM5 (NM_001025295) Human Over-expression Lysate

Sign In for Pricing
View Details
Frataxin (FXN) (NM_001161706) Human Over-expression Lysate
LC431136 20 µg

Frataxin (FXN) (NM_001161706) Human Over-expression Lysate

Sign In for Pricing
View Details