What is the catalog number for CHRNG antibody - N-terminal region (AVARP13024_P050)?

The catalog number for CHRNG antibody - N-terminal region (AVARP13024_P050) is AVARP13024_P050.

What sizes are available for CHRNG antibody - N-terminal region (AVARP13024_P050)?

CHRNG antibody - N-terminal region (AVARP13024_P050) is available in the following size(s): 100 µL.

Is CHRNG antibody - N-terminal region (AVARP13024_P050) in stock?

CHRNG antibody - N-terminal region (AVARP13024_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

CHRNG antibody - N-terminal region (AVARP13024_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Cholinergic receptor, nicotinic, gamma (muscle)

Gene Aliases

ACHRG

Gene ID

1146

Swiss Prot

P07510

Accession Number

NP_005190

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNG

Target

For background information on the acetylcholine receptor (AChR), see CHRNA1. Two forms of AChR are found in mammalian skeletal muscle cells. The mature form is predominant in innervated adult muscle and the embryonic form is present in fetal and denervated muscle. Embryonic and mature AChR differ by the replacement of the gamma subunit in the pentameric glycoprotein complex by its isoform, the epsilon subunit, which is specific to the mature AChR subtype. This switch is mediated by ARIA (acetylcholine receptor-inducing activity.For background information on the acetylcholine receptor (AChR), see CHRNA1 (MIM 100690) . Two forms of AChR are found in mammalian skeletal muscle cells. The mature form is predominant in innervated adult muscle and the embryonic form is present in fetal and denervated muscle. Embryonic and mature AChR differ by the replacement of the gamma subunit in the pentameric glycoprotein complex by its isoform, the epsilon subunit (MIM 100725), which is specific to the mature AChR subtype. This switch is mediated by ARIA (acetylcholine receptor-inducing activity; MIM 142445) .[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2187 AK125362.1 1-2187

Partner Proteins

NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP10-9; KRTAP10-7; KRT31; CHRNA1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol