TFDP1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Transcription factor Dp-1

Gene Aliases

DP1, DILC, Dp-1, DRTF1

Gene ID

7027

Swiss Prot

Q14186

Accession Number

NP_009042

Reactivity

Human, Mouse, Cow, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TFDP1

Target

The E2F transcription factor family regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors and may have a role in progression of some hepatocellular carcinomas by promoting growth of the tumor cells. The E2F transcription factor family (see MIM 189971) regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors; see TFDP2 (MIM 602160) .[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

UBC; E2F6; E2F4; SIAH1; E2F3; E2F2; E2F1; CDK6; PRPF31; CDK2; CDK1; SOCS3; RB1; PCGF6; RYBP; YAF2; RNF2; ELAVL1; LIN9; LIN54; LIN37; RBL2; SERTAD2; NPDC1; E2F5; TP53; RBL1; CDK3; TP53BP1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDED

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol