Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

TNF receptor-associated factor 1

Gene Aliases

EBI6, MGC:10353

Gene ID

7185

Swiss Prot

Q13077

Accession Number

NP_005649

Reactivity

Human, Mouse, Cow, Dog, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRAF1

Target

This protein is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV) . EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors.The protein encoded by this gene is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV) . EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

ZNF662; KLHL38; TRIM42; RTP5; SSC5D; MORN3; POM121L4P; OLIG3; CCDC116; ZNF564; SLC25A48; ALS2CR11; LOC149950; ZNF417; TMC8; ZNF572; RBM45; C1orf216; ZNF440; TBC1D16; HAUS1; SYCE1; ZNF502; C5orf30; CCDC120; FBF1; ZNF587; BEX2; LCOR; FAM161A; PLEKHN1; RASSF

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 84%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

46kDa

Protein Length

416

NCBI Gene Symbol

TRAF1

Host or Source

Rabbit

Protein Name

TNF receptor-associated factor 1

Gene Name URL

TRAF1

Nucleotide Accession Number

NM_005658

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit D-Xylose ELISA Kit
MBS7257329-01 48 Well

Rabbit D-Xylose ELISA Kit

Ask
View Details
Rabbit D-Xylose ELISA Kit
MBS7257329-02 96 Well

Rabbit D-Xylose ELISA Kit

Ask
View Details
Rabbit D-Xylose ELISA Kit
MBS7257329-03 5x 96 Well

Rabbit D-Xylose ELISA Kit

Ask
View Details
Rabbit D-Xylose ELISA Kit
MBS7257329-04 10x 96 Well

Rabbit D-Xylose ELISA Kit

Ask
View Details
Edoxaban Impurity 28
RM-E042828-01 10 mg

Edoxaban Impurity 28

Ask
View Details
Edoxaban Impurity 28
RM-E042828-02 25 mg

Edoxaban Impurity 28

Ask
View Details