What is the catalog number for Gja3 Antibody-C-terminal region?

The catalog number for Gja3 Antibody-C-terminal region is ARP97779_P050.

What sizes are available for Gja3 Antibody-C-terminal region?

Gja3 Antibody-C-terminal region is available in the following size(s): 100 µL.

Is Gja3 Antibody-C-terminal region in stock?

Gja3 Antibody-C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

Gja3 Antibody-C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Gap junction protein, alpha 3

Gene Aliases

Cx43, Cx46, Gja-, Cnx46, Cxnj1, Gja-3

Gene ID

14611

Swiss Prot

Q64448

Accession Number

NP_001258552.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse GJA3

Target

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LQESALVVTPEEGEQALATTVEMHSPPLVLLDPGRSSKSSNGRARPGDLA

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol