What is the catalog number for ADCY5 Antibody Middle region?

The catalog number for ADCY5 Antibody Middle region is ARP97700_P050.

What sizes are available for ADCY5 Antibody Middle region?

ADCY5 Antibody Middle region is available in the following size(s): 100 µL.

Is ADCY5 Antibody Middle region in stock?

ADCY5 Antibody Middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

ADCY5 Antibody Middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Adenylate cyclase 5

Gene Aliases

AC5, FDFM

Gene ID

111

Swiss Prot

O95622

Accession Number

NP_001186571.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ADCY5

Target

This gene encodes a member of the membrane-bound adenylyl cyclase enzymes. Adenylyl cyclases mediate G protein-coupled receptor signaling through the synthesis of the second messenger cAMP. Activity of the encoded protein is stimulated by the Gs alpha subunit of G protein-coupled receptors and is inhibited by protein kinase A, calcium and Gi alpha subunits. Single nucleotide polymorphisms in this gene may be associated with low birth weight and type 2 diabetes. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol