Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP100 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Nuclear antigen Sp100

Gene Aliases

A430075G10Rik

Gene ID

20684

Swiss Prot

O35892

Accession Number

NP_001300641.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse SP100

Target

Together with PML, this tumor suppressor is a major constituent of the PML bodies, a subnuclear organelle involved in a large number of physiological processes including cell growth, differentiation and apoptosis. Functions as a transcriptional coactivator of ETS1 and ETS2. Under certain conditions, it may also act as a corepressor of ETS1 preventing its binding to DNA. Through the regulation of ETS1 it may play a role in angiogenesis, controlling endothelial cell motility and invasion. Through interaction with the MRN complex it may be involved in the regulation of telomeres lengthening. May also regulate TP53-mediated transcription and through CASP8AP2, regulate FAS-mediated apoptosis. May also play a role in infection by viruses through mechanisms that may involve chromatin and/or transcriptional regulation (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DFEIEGNCEKAKNWRQSIRCKGWTLRELIQKGVLQDPPRKKKETPRNPRQ

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

53 kDa

Protein Length

482

NCBI Gene Symbol

SP100

Host or Source

Rabbit

Protein Name

Nuclear autoantigen Sp-100

Gene Name URL

SP100

Nucleotide Accession Number

NM_001313712.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Probable phospholipid-transporting ATPase IK (ATP8B3) Human ELISA Kit
G1352 96 Tests

Probable phospholipid-transporting ATPase IK (ATP8B3) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Zymomonas mobilis DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1408471-01 0.02 mg (E-Coli)

Recombinant Zymomonas mobilis DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Zymomonas mobilis DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1408471-02 0.1 mg (E-Coli)

Recombinant Zymomonas mobilis DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Zymomonas mobilis DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1408471-03 0.02 mg (Yeast)

Recombinant Zymomonas mobilis DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Zymomonas mobilis DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1408471-04 0.1 mg (Yeast)

Recombinant Zymomonas mobilis DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Zymomonas mobilis DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1408471-05 0.02 mg (Baculovirus)

Recombinant Zymomonas mobilis DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details