What is the catalog number for DMC1 Antibody-N-terminal region?

The catalog number for DMC1 Antibody-N-terminal region is ARP97445_P050.

What sizes are available for DMC1 Antibody-N-terminal region?

DMC1 Antibody-N-terminal region is available in the following size(s): 100 µL.

Is DMC1 Antibody-N-terminal region in stock?

DMC1 Antibody-N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

DMC1 Antibody-N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

DNA meiotic recombinase 1

Gene Aliases

DMC1H, LIM15, dJ199H16.1

Gene ID

11144

Swiss Prot

Q14565-2

Accession Number

NP_001265137.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DMC1

Target

This gene encodes a member of the superfamily of recombinases (also called DNA strand-exchange proteins) . Recombinases are important for repairing double-strand DNA breaks during mitosis and meiosis. This protein, which is evolutionarily conserved, is reported to be essential for meiotic homologous recombination and may thus play an important role in generating diversity of genetic information. Alternative splicing results in multiple transcript variants.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMT

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol