Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPARGC1A Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

PPARG coactivator 1 alpha

Gene Aliases

LEM6, PGC1, PGC1A, PGC-1v, PPARGC1, PGC-1alpha, PGC-1 (alpha)

Gene ID

10891

Swiss Prot

Q9UBK2-5

Accession Number

NP_001317680.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle terminal region of human PPARGC1A

Target

The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs) . It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNE

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

31 kDa

Protein Length

289

NCBI Gene Symbol

PPARGC1A

Host or Source

Rabbit

Protein Name

Peroxisome proliferator-activated receptor gamma coactivator 1-alpha

Gene Name URL

PPARGC1A

Nucleotide Accession Number

NM_001330751.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 11 (WNT11)
MBS2139407-01 0.1 mL

Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 11 (WNT11)

Sign In for Pricing
View Details
Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 11 (WNT11)
MBS2139407-02 0.2 mL

Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 11 (WNT11)

Sign In for Pricing
View Details
Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 11 (WNT11)
MBS2139407-03 0.5 mL

Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 11 (WNT11)

Sign In for Pricing
View Details
Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 11 (WNT11)
MBS2139407-04 1 mL

Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 11 (WNT11)

Sign In for Pricing
View Details
Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 11 (WNT11)
MBS2139407-05 5 mL

Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 11 (WNT11)

Sign In for Pricing
View Details
Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 11 (WNT11)
MBS2139407-06 5x 5 mL

Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 11 (WNT11)

Sign In for Pricing
View Details