Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKB1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Nuclear factor kappa B subunit 1

Gene Aliases

KBF1, EBP-1, NF-kB, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B1, NF-kappabeta

Gene ID

4790

Swiss Prot

P19838

Accession Number

NP_001158884.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NFKB1

Target

This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Alternative splicing results in multiple transcript variants encoding different isoforms, at least one of which is proteolytically processed.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDST

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

106 kDa

Protein Length

968

NCBI Gene Symbol

NFKB1

Host or Source

Rabbit

Protein Name

Nuclear factor NF-kappa-B p105 subunit

Gene Name URL

NFKB1

Nucleotide Accession Number

NM_001165412.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-500 1x 500 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF647 conjugate, 0.1mg/mL
BNC471045-500 1x 500 µL

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-500 1x 500 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details