What is the catalog number for Ambra1 Antibody-C-terminal region?

The catalog number for Ambra1 Antibody-C-terminal region is ARP97173_P050.

What sizes are available for Ambra1 Antibody-C-terminal region?

Ambra1 Antibody-C-terminal region is available in the following size(s): 100 µL.

Is Ambra1 Antibody-C-terminal region in stock?

Ambra1 Antibody-C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

Ambra1 Antibody-C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

AA474864, AV021921, mKIAA1736, A130023A14, 2310079H06Rik, D030051N19Rik

Gene Aliases

AA474864, AV021921, mKIAA1736, A130023A14, 2310079H06Rik, D030051N19Rik

Gene ID

228361

Swiss Prot

A2AH22-4

Accession Number

NP_001074223.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse AMBRA1

Target

Regulates autophagy and development of the nervous system. Involved in autophagy in controlling protein turnover during neuronal development, and in regulating normal cell survival and proliferation.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ERTVGVAFNQETGHWERIYTQSSRSGTVSQEALHQDMPEESSEEDSLRRL

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol