What is the catalog number for RPS6KB1 Antibody - N-terminal region?

The catalog number for RPS6KB1 Antibody - N-terminal region is ARP97050_P050-25UL.

What sizes are available for RPS6KB1 Antibody - N-terminal region?

RPS6KB1 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is RPS6KB1 Antibody - N-terminal region in stock?

RPS6KB1 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

RPS6KB1 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

S6K, PS6K, S6K1, STK14A, p70-S6K, p70 S6KA, p70-alpha, S6K-beta-1, p70 (S6K) -alpha

Gene Aliases

S6K, PS6K, S6K1, STK14A, p70-S6K, p70 S6KA, p70-alpha, S6K-beta-1, p70 (S6K) -alpha

Gene ID

6198

Swiss Prot

Q9UBS0

Accession Number

NP_003943.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RPS6KB1

Target

This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations. There are two pseudogenes for this gene on chromosome 17.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILEC

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

53 kDa

Protein Length

482

NCBI Gene Symbol

RPS6KB1

Host or Source

Rabbit

Protein Name

Gene Name URL