What is the catalog number for UNKL Antibody - N-terminal region?

The catalog number for UNKL Antibody - N-terminal region is ARP97013_P050-25UL.

What sizes are available for UNKL Antibody - N-terminal region?

UNKL Antibody - N-terminal region is available in the following size(s): 25 µL.

Is UNKL Antibody - N-terminal region in stock?

UNKL Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

UNKL Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

ZC3H5L, C16orf28, ZC3HDC5L

Gene Aliases

ZC3H5L, C16orf28, ZC3HDC5L

Gene ID

64718

Swiss Prot

Q9C0B0

Accession Number

NP_001073888.2

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UNKL

Target

This gene encodes a RING finger protein that may function in Rac signaling. It can bind to Brg/Brm-associated factor 60b and can promote its ubiquitination. Alternative splicing of this gene results in multiple transcript variants.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SEEPRWQETAYVLGNYKTEPCKKPPRLCRQGYACPYYHNSKDRRRSPRKH

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol