What is the catalog number for LY9 Antibody - middle region?

The catalog number for LY9 Antibody - middle region is ARP96899_P050-25UL.

What sizes are available for LY9 Antibody - middle region?

LY9 Antibody - middle region is available in the following size(s): 25 µL.

Is LY9 Antibody - middle region in stock?

LY9 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

LY9 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Lymphocyte antigen 9

Gene Aliases

Hly9, mLY9, CD229, SLAMF3

Gene ID

4063

Swiss Prot

Q9HBG7-3

Accession Number

NP_001028839.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LY9

Target

LY9 belongs to the SLAM family of immunomodulatory receptors (see SLAMF1; MIM 603492) and interacts with the adaptor molecule SAP (SH2D1A; MIM 300490) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

WLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIED

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol