What is the catalog number for ATG9A Antibody - C-terminal region?

The catalog number for ATG9A Antibody - C-terminal region is ARP96887_P050-25UL.

What sizes are available for ATG9A Antibody - C-terminal region?

ATG9A Antibody - C-terminal region is available in the following size(s): 25 µL.

Is ATG9A Antibody - C-terminal region in stock?

ATG9A Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

ATG9A Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

MATG9, APG9L1, MGD3208

Gene Aliases

MATG9, APG9L1, MGD3208

Gene ID

79065

Swiss Prot

Q7Z3C6-2

Accession Number

NP_001070666.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ATG9A

Target

Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS), the nucleating site for formation of the sequestering vesicle. Cycles between a juxta-nuclear trans-Golgi network compartment and late endosomes. Nutrient starvation induces accumulation on autophagosomes. Starvation-dependent trafficking requires ULK1, ATG13 and SUPT20H.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SLHALYMHQLHKQQAQAEPERHVWHRRESDESGESAPDEGGEGARAPQSI

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol