What is the catalog number for AP5Z1 Antibody - middle region?

The catalog number for AP5Z1 Antibody - middle region is ARP96826_P050-25UL.

What sizes are available for AP5Z1 Antibody - middle region?

AP5Z1 Antibody - middle region is available in the following size(s): 25 µL.

Is AP5Z1 Antibody - middle region in stock?

AP5Z1 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

AP5Z1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Zeta, SPG48, KIAA0415

Gene Aliases

Zeta, SPG48, KIAA0415

Gene ID

9907

Swiss Prot

O43299-3

Accession Number

NP_055670.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AP5Z1

Target

This gene was identified by genome-wide screen for genes involved in homologous recombination DNA double-strand break repair (HR-DSBR) . The encoded protein was found in a complex with other proteins that have a role in HR-DSBR. Knockdown of this gene reduced homologous recombination, and mutations in this gene were found in patients with spastic paraplegia. It was concluded that this gene likely encodes a helicase.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACL

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol