Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tomt Antibody Middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Transmembrane O-methyltransferase

Gene Aliases

Comt, Comt2, F930017I19Rik

Gene ID

791260

Swiss Prot

B6CZ62

Accession Number

NP_001075148.1

Reactivity

Rat

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of rat TOMT

Target

Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones (By similarity) . Required for auditory function (By similarity) . Component of the cochlear hair cell's mechanotransduction (MET) machinery. Involved in the assembly of the asymmetric tip-link MET complex. Required for transportation of TMC1 and TMC2 proteins into the mechanically sensitive stereocilia of the hair cells. The function in MET is independent of the enzymatic activity (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FSYVLTHALPGDPGHILTTLDHWSSCCEYLSHMGPVKGQILMRLVEEKAP

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

29 kDa

Protein Length

258

NCBI Gene Symbol

TOMT

Host or Source

Rabbit

Protein Name

Transmembrane O-methyltransferase

Gene Name URL

TOMT

Nucleotide Accession Number

NM_001081679.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human BARHL1 shRNA (UAS) - Lentiviral human BARHL1 shRNA (UAS, RFP) plasmid
GTR15127981 1 Vial

Lentiviral human BARHL1 shRNA (UAS) - Lentiviral human BARHL1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Luteinizing Hormone (LH) ELISA Kit
60047 96 Tests

Luteinizing Hormone (LH) ELISA Kit

Sign In for Pricing
View Details
CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450 (PA) ) (AP) discontinued
245146-AP 100 µL

CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450 (PA) ) (AP) discontinued

Sign In for Pricing
View Details
MSLN Protein (C-His, Human)
P520195 100 µg

MSLN Protein (C-His, Human)

Sign In for Pricing
View Details
COLD1 Antibody
orb839153 2 mg

COLD1 Antibody

Sign In for Pricing
View Details
PRKRA (S246) (Interferon-inducible Double Stranded RNA-dependent Protein Kinase Activator A, Protein Kinase, Interferon-inducible Double Stranded RNA-dependent Activator, Protein Activator Of The Interferon-induced Protein Kinase, PKR-associated Protein X, PKR-associating Protein X, HSD14, HSD-14, PACT, RAX) (MaxLight 750) discontinued
P9104-92H-ML750 100 µL

PRKRA (S246) (Interferon-inducible Double Stranded RNA-dependent Protein Kinase Activator A, Protein Kinase, Interferon-inducible Double Stranded RNA-dependent Activator, Protein Activator Of The Interferon-induced Protein Kinase, PKR-associated Protein X, PKR-associating Protein X, HSD14, HSD-14, PACT, RAX) (MaxLight 750) discontinued

Sign In for Pricing
View Details