What is the catalog number for Cyp2c70 Antibody (ARP94482_P050)?

The catalog number for Cyp2c70 Antibody (ARP94482_P050) is ARP94482_P050.

What sizes are available for Cyp2c70 Antibody (ARP94482_P050)?

Cyp2c70 Antibody (ARP94482_P050) is available in the following size(s): 100 µL.

Is Cyp2c70 Antibody (ARP94482_P050) in stock?

Cyp2c70 Antibody (ARP94482_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Cyp2c70 Antibody (ARP94482_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Cytochrome P450, family 2, subfamily c, polypeptide 70

Gene ID

226105

Swiss Prot

Q91W64

Accession Number

NP_663474.2

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle terminal region of mouse CYP2C70

Target

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RGYHIPKGTSVMACLTSVLNDDKEFPNPEKFDPGHFLDEKGNFKKSDYFV

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol