Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hbb Antibody (ARP93419_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Hemoglobin, beta adult minor chain

Gene Aliases

Hbb2, Hbbt2, beta2, AI036344

Gene ID

15130

Swiss Prot

P02089

Accession Number

NP_058652.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse HBB-B2

Target

This gene encodes a beta polypeptide chain found in adult hemoglobin, which consists of a tetramer of two alpha chains and two beta chains, and which functions in the transport of oxygen to various peripheral tissues. This gene is one of a cluster of beta-hemoglobin genes that are distally regulated by a locus control region, and which are organized along the chromosome in the order of their developmental expression. In mouse, two major strain-specific haplotypes of the beta-globin gene cluster are found - a "single" haplotype found in C57BL/-type strains, which includes two highly similar adult beta-globin genes, beta s and beta t, and a "diffuse" haplotype found in strains such as BALB/c and 129Sv, which includes two somewhat diverse adult beta-globin genes, beta-major and beta-minor. This gene represents the beta-minor adult gene found in the "diffuse" haplotype. Primary chromosome 7 of the mouse reference genome assembly, which is derived from C57BL/6 strain mice, represents the "single" haplotype, while the "diffuse" haplotype is represented in the reference genome collection by the BALB/c strain alternate contig, NT_095534.1.Â

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVA

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

16 kDa

Protein Length

147

NCBI Gene Symbol

HBB-B2

Host or Source

Rabbit

Protein Name

Hemoglobin subunit beta-2

Gene Name URL

HBB-B2

Nucleotide Accession Number

NM_016956.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal bcl-x Antibody (BCL2L1/1762) [PE]
NBP3-08580PE 0.1 mL

Mouse Monoclonal bcl-x Antibody (BCL2L1/1762) [PE]

Sign In for Pricing
View Details
Kif3a (NM_008443) Mouse Tagged Lenti ORF Clone
MR210130L3 10 µg

Kif3a (NM_008443) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse anti-human CD42b (Platelet GPIb) monoclonal antibody
656 1 mL

Mouse anti-human CD42b (Platelet GPIb) monoclonal antibody

Sign In for Pricing
View Details
TM6SF1 (NM_023003) Human 3' UTR Clone
SC208901 10 µg

TM6SF1 (NM_023003) Human 3' UTR Clone

Sign In for Pricing
View Details
F9 Antibody
MBS859749-01 0.1 mg

F9 Antibody

Sign In for Pricing
View Details
F9 Antibody
MBS859749-02 0.1 mL (AF405L)

F9 Antibody

Sign In for Pricing
View Details