What is the catalog number for Serpina3g Antibody (ARP92883_P050)?

The catalog number for Serpina3g Antibody (ARP92883_P050) is ARP92883_P050.

What sizes are available for Serpina3g Antibody (ARP92883_P050)?

Serpina3g Antibody (ARP92883_P050) is available in the following size(s): 100 µL.

Is Serpina3g Antibody (ARP92883_P050) in stock?

Serpina3g Antibody (ARP92883_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

Serpina3g Antibody (ARP92883_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Serine (or cysteine) peptidase inhibitor, clade A, member 3G

Gene Aliases

S, 2A, 2A2, Spi, spi2, Spi2A, Spi2-1, Spi2/e, AI119734, Spi2/eb.1

Gene ID

20715

Swiss Prot

Q5I2A0

Accession Number

NP_033277.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle terminal region of mouse SERPINA3G

Target

Serine and cysteine protease inhibitor. Can inhibit lysosomal papain-like proteases including the cathepsins B, G, H, K, L and V. Ineffective against elastase, granzyme A, granzyme B, or caspases 3, 8 or 9. Inhibition of cytoplasmic cathepsin B following release from the lysosome may protect cells from apoptosis. This may facilitate the survival of progenitor T-cells and the subsequent development of long term memory CD8 T-cells.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GKWKNPFDPNDTFKSEFYLDEKRSVIVSMMKTGYLTTPYFRDEELSCTVV

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol