What is the catalog number for P6K2 Antibody - middle region?

The catalog number for P6K2 Antibody - middle region is ARP92711_P050-25UL.

What sizes are available for P6K2 Antibody - middle region?

P6K2 Antibody - middle region is available in the following size(s): 25 µL.

Is P6K2 Antibody - middle region in stock?

P6K2 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

P6K2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Inositol hexaphosphate kinase 2

Gene Aliases

Ihp, Ihpk2, AW050208, 1500005N04Rik

Gene ID

76500

Swiss Prot

Q80V72

Accession Number

NP_083910.2

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse IP6K2

Target

Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5) . Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. Was first identified because of its ability to stimulate Na+-dependent phosphate cotransport (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQST

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol