What is the catalog number for OASL2 Antibody - middle region?

The catalog number for OASL2 Antibody - middle region is ARP91798_P050-25UL.

What sizes are available for OASL2 Antibody - middle region?

OASL2 Antibody - middle region is available in the following size(s): 25 µL.

Is OASL2 Antibody - middle region in stock?

OASL2 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

OASL2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

2'-5' oligoadenylate synthetase-like 2

Gene Aliases

Mmu-, Oasl, M1204, Mmu-OASL

Gene ID

23962

Swiss Prot

Q5MYT9

Accession Number

NP_035984.2

Reactivity

Rat

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of rat OASL2

Target

Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. Synthesizes oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VRNFLKKQLKGDRPIILDPADPTNNLGRRKGWEQVAAEAAFCLLQVCCTT

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol