Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Oasl2 Antibody Middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

2'-5' oligoadenylate synthetase-like 2

Gene Aliases

Mmu-, Oasl, M1204, Mmu-OASL

Gene ID

23962

Swiss Prot

Q5MYT9

Accession Number

NP_035984.2

Reactivity

Rat

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of rat OASL2

Target

Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. Synthesizes oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VRNFLKKQLKGDRPIILDPADPTNNLGRRKGWEQVAAEAAFCLLQVCCTT

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

59 kDa

Protein Length

511

NCBI Gene Symbol

OASL2

Host or Source

Rabbit

Protein Name

2'-5'-oligoadenylate synthase-like protein 2

Gene Name URL

OASL2

Nucleotide Accession Number

NM_011854.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Mi2-Anti-body ELISA Kit
NSL0990r 96 Tests

Rat Anti-Mi2-Anti-body ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Mef2b shRNA (UAS) - Lentiviral mouse Mef2b shRNA (UAS) (25)
GTR15305072 1 Vial

Lentiviral mouse Mef2b shRNA (UAS) - Lentiviral mouse Mef2b shRNA (UAS) (25)

Sign In for Pricing
View Details
ZNF262 (CDIR, Cell Death inhibiting RNA, MYM, Zinc Finger Protein 262, Zinc Finger, MYM Type 4, ZMYM4, ZNF198L3) discontinued
226763-01 50 µL

ZNF262 (CDIR, Cell Death inhibiting RNA, MYM, Zinc Finger Protein 262, Zinc Finger, MYM Type 4, ZMYM4, ZNF198L3) discontinued

Sign In for Pricing
View Details
ZNF262 (CDIR, Cell Death inhibiting RNA, MYM, Zinc Finger Protein 262, Zinc Finger, MYM Type 4, ZMYM4, ZNF198L3) discontinued
226763-02 100 µL

ZNF262 (CDIR, Cell Death inhibiting RNA, MYM, Zinc Finger Protein 262, Zinc Finger, MYM Type 4, ZMYM4, ZNF198L3) discontinued

Sign In for Pricing
View Details
NDUFB8 Protein Vector (Human) (pPB-C-His)
PV027977 500 ng

NDUFB8 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ANKFY1 Rabbit Polyclonal Antibody (C-term)
E28PB2212 100 µL

ANKFY1 Rabbit Polyclonal Antibody (C-term)

Sign In for Pricing
View Details