What is the catalog number for TAPBP Antibody - middle region?

The catalog number for TAPBP Antibody - middle region is ARP91033_P050-25UL.

What sizes are available for TAPBP Antibody - middle region?

TAPBP Antibody - middle region is available in the following size(s): 25 µL.

Is TAPBP Antibody - middle region in stock?

TAPBP Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

TAPBP Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

TAP binding protein

Gene Aliases

T, TPN, D17Wsu91, D17Wsu91e

Gene ID

21356

Swiss Prot

Q9R233

Accession Number

NP_033344.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse TAPBP

Target

Involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (peptide loading) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TPGLAGRMPPAQEKATAFAAWDDDEPWGPWTGNGTFWLPAVKPSQEGVYL

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol