What is the catalog number for Pou3f1 Antibody Middle region?

The catalog number for Pou3f1 Antibody Middle region is ARP90982_P050.

What sizes are available for Pou3f1 Antibody Middle region?

Pou3f1 Antibody Middle region is available in the following size(s): 100 µL.

Is Pou3f1 Antibody Middle region in stock?

Pou3f1 Antibody Middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

Pou3f1 Antibody Middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

POU domain, class 3, transcription factor 1

Gene Aliases

S, Oct, Otf, Tst, Oct-, Oct6, Otf6, Scip, Tst-, Tst1, Oct-6, Otf-6, Test1, Tst-1

Gene ID

18991

Swiss Prot

P21952

Accession Number

NP_035271.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse POU3F1

Target

Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') . Thought to be involved in early embryogenesis and neurogenesis.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPK

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol