Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scd2 Antibody (ARP90756_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Stearoyl-Coenzyme A desaturase 2

Gene Aliases

Scd-, swty, Scd-2, Mir5114, mir-5114

Gene ID

20250

Swiss Prot

P13011

Accession Number

NP_033154.2

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse SCD2

Target

Stearyl-CoA desaturase that utilizes O2 and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. Catalyzes the insertion of a cis double bond at the delta-9 position into fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA. Gives rise to a mixture of 16:1 and 18:1 unsaturated fatty acids. Contributes to the biosynthesis of membrane phospholipids, cholesterol esters and triglycerides, especially during embryonic development and in neonates. Important for normal permeability barrier function of the skin in neonate.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SATTTITAPPSGGQQNGGEKFEKSSHHWGADVRPELKDDLYDPTYQDDEG

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

39 kDa

Protein Length

358

NCBI Gene Symbol

SCD2

Host or Source

Rabbit

Protein Name

Acyl-CoA desaturase 2

Gene Name URL

SCD2

Nucleotide Accession Number

NM_009128.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ulipristal Impurity 17
RM-U121617-01 10 mg

Ulipristal Impurity 17

Sign In for Pricing
View Details
Ulipristal Impurity 17
RM-U121617-02 25 mg

Ulipristal Impurity 17

Sign In for Pricing
View Details
Ulipristal Impurity 17
RM-U121617-03 50 mg

Ulipristal Impurity 17

Sign In for Pricing
View Details
Ulipristal Impurity 17
RM-U121617-04 100 mg

Ulipristal Impurity 17

Sign In for Pricing
View Details
CC2D1A (AKI1, Coiled-coil and C2 Domain-containing Protein 1A, Akt Kinase-interacting Protein 1, Five Prime Repressor Element Under Dual Repression-binding Protein 1, Putative NF-kappa-B-activating Protein 023N, FLJ20241, FLJ41160) (FITC)
MBS6372457-01 0.1 mL

CC2D1A (AKI1, Coiled-coil and C2 Domain-containing Protein 1A, Akt Kinase-interacting Protein 1, Five Prime Repressor Element Under Dual Repression-binding Protein 1, Putative NF-kappa-B-activating Protein 023N, FLJ20241, FLJ41160) (FITC)

Sign In for Pricing
View Details
CC2D1A (AKI1, Coiled-coil and C2 Domain-containing Protein 1A, Akt Kinase-interacting Protein 1, Five Prime Repressor Element Under Dual Repression-binding Protein 1, Putative NF-kappa-B-activating Protein 023N, FLJ20241, FLJ41160) (FITC)
MBS6372457-02 5x 0.1 mL

CC2D1A (AKI1, Coiled-coil and C2 Domain-containing Protein 1A, Akt Kinase-interacting Protein 1, Five Prime Repressor Element Under Dual Repression-binding Protein 1, Putative NF-kappa-B-activating Protein 023N, FLJ20241, FLJ41160) (FITC)

Sign In for Pricing
View Details