Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLST Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)

Gene Aliases

DLTS, 1600017E01Rik, 4632413C10Rik, 4930529O08Rik

Gene ID

78920

Swiss Prot

Q9D2G2

Accession Number

NP_084501.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse DLST

Target

Dihydrolipoamide succinyltransferase (E2) component of the 2-oxoglutarate dehydrogenase complex (By similarity) . The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2 (By similarity) . The 2-oxoglutarate dehydrogenase complex is mainly active in the mitochondrion. A fraction of the 2-oxoglutarate dehydrogenase complex also localizes in the nucleus and is required for lysine succinylation of histones: associates with KAT2A on chromatin and provides succinyl-CoA to histone succinyltransferase KAT2A (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLKEAQNT

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

49 kDa

Protein Length

454

NCBI Gene Symbol

DLST

Host or Source

Rabbit

Protein Name

Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial

Gene Name URL

DLST

Nucleotide Accession Number

NM_030225.4

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPPA5, NT (DPPA5, ESG1, Developmental pluripotency-associated 5 protein, Embryonal stem cell-specific gene 1 protein) (Azide free) (HRP)
MBS6293393-01 0.2 mL

DPPA5, NT (DPPA5, ESG1, Developmental pluripotency-associated 5 protein, Embryonal stem cell-specific gene 1 protein) (Azide free) (HRP)

Sign In for Pricing
View Details
DPPA5, NT (DPPA5, ESG1, Developmental pluripotency-associated 5 protein, Embryonal stem cell-specific gene 1 protein) (Azide free) (HRP)
MBS6293393-02 5x 0.2 mL

DPPA5, NT (DPPA5, ESG1, Developmental pluripotency-associated 5 protein, Embryonal stem cell-specific gene 1 protein) (Azide free) (HRP)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) WIN1 Polyclonal Antibody
MBS7181603 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) WIN1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B UPF0758 protein YE0063 (YE0063)
MBS1261357-01 0.02 mg (E-Coli)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B UPF0758 protein YE0063 (YE0063)

Sign In for Pricing
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B UPF0758 protein YE0063 (YE0063)
MBS1261357-02 0.1 mg (E-Coli)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B UPF0758 protein YE0063 (YE0063)

Sign In for Pricing
View Details
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B UPF0758 protein YE0063 (YE0063)
MBS1261357-03 0.02 mg (Yeast)

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B UPF0758 protein YE0063 (YE0063)

Sign In for Pricing
View Details