Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1A1, Human (His)

SULT1A1 Protein, Human (His) is the recombinant human-derived SULT1A1 protein, expressed by E. coli, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SULT1A1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult1a1-protein-human-his.html

Purity

99.00

Smiles

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Molecular Formula

6817 (Gene_ID) AAH00923.1 (M1-L295) (Accession)

Molecular Weight

Approximately 32-34 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RAB23 activation kit by CRISPRa
GA109957 1 Kit

Human RAB23 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF647 conjugate, 0.1mg/mL
BNC473128-500 1x 500 µL

Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD-L1 (CD274) (NM_014143) Human Recombinant Protein
TP710226 20 µg

PD-L1 (CD274) (NM_014143) Human Recombinant Protein

Sign In for Pricing
View Details
SB431542
SIH-511-25MG 25 mg

SB431542

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF405S conjugate, 0.1mg/mL
BNC041855-500 1x 500 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS711454 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details