What is the catalog number for PRR7 Antibody - middle region?

The catalog number for PRR7 Antibody - middle region is ARP90397_P050-25UL.

What sizes are available for PRR7 Antibody - middle region?

PRR7 Antibody - middle region is available in the following size(s): 25 µL.

Is PRR7 Antibody - middle region in stock?

PRR7 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

PRR7 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Proline rich 7 (synaptic)

Gene Aliases

XM_484263

Gene ID

432763

Swiss Prot

Q3V0I2

Accession Number

NP_001025467.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse PRR7

Target

Acts as a synapse-to-nucleus messenger to promote NMDA receptor-mediated excitotoxicity in neurons in a JUN-dependent manner (By similarity) . Inhibits ubiquitination-mediated degradation and promotes phosphorylation and transcriptional activity of transcription factor JUN (By similarity) . Might play a redundant role in the regulation of T cell receptor signaling. Might promote apoptosis in T cells (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPS

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol