Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD247 Antibody - middlel region

Product Specifications

CAS Number

9007-83-4

Gene Name

CD247 antigen

Gene Aliases

Cd3, T3z, TCR, Cd3h, Cd3z, Tcrk, Tcrz, CD3-et, CD3zet, CD3-zet, Cd3-eta, Cd3zeta, AW552088, Cd3-zeta, A430104F18, 4930549J05Rik, A430104F18Rik

Gene ID

12503

Swiss Prot

P24161

Accession Number

NP_001106862.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse CD247

Target

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYD

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

18 kDa

Protein Length

164

NCBI Gene Symbol

CD247

Host or Source

Rabbit

Protein Name

CD247 antigen

Gene Name URL

CD247

Nucleotide Accession Number

NM_001113391.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HLA A2 Antibody (BB7.2) [Allophycocyanin/Cy7]
NBP1-44896APCCY7 0.1 mL

Mouse Monoclonal HLA A2 Antibody (BB7.2) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Polymyxin B1-I Sulfate EvoPure®
P038-10MG 10 mg

Polymyxin B1-I Sulfate EvoPure®

Sign In for Pricing
View Details
Yellow Fever Virus E Protein IgG Antibody ELISA Kit, Human
VACY-1022-CY653 1 Kit

Yellow Fever Virus E Protein IgG Antibody ELISA Kit, Human

Sign In for Pricing
View Details
BID, phosphorylated (Ser61) (Bcl-2 Interacting Domain, BH3 Interacting Domain Death Agonist) (MaxLight 490)
B1095-01W-ML490 100 µL

BID, phosphorylated (Ser61) (Bcl-2 Interacting Domain, BH3 Interacting Domain Death Agonist) (MaxLight 490)

Sign In for Pricing
View Details
Goat Lipopolysaccharides ELISA Kit
MBS743566-01 48 Well

Goat Lipopolysaccharides ELISA Kit

Sign In for Pricing
View Details
Goat Lipopolysaccharides ELISA Kit
MBS743566-02 96 Well

Goat Lipopolysaccharides ELISA Kit

Sign In for Pricing
View Details