Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ube2n Antibody Middlel region

Product Specifications

CAS Number

9007-83-4

Gene Name

Ubiquitin-conjugating enzyme E2N

Gene Aliases

UBC13, AL022654, BB101821, 1500026J17Rik

Gene ID

93765

Swiss Prot

P61089

Accession Number

NP_542127.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse UBE2N

Target

The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains (PubMed:22424771, PubMed:28039360) . This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

IRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

16 kDa

Protein Length

152

NCBI Gene Symbol

UBE2N

Host or Source

Rabbit

Protein Name

Ubiquitin-conjugating enzyme E2 N

Gene Name URL

UBE2N

Nucleotide Accession Number

NM_080560.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NACA (NM_005594) Human Recombinant Protein
TP311268M 100 µg

NACA (NM_005594) Human Recombinant Protein

Sign In for Pricing
View Details
CCDC18 Human Gene Knockout Kit (CRISPR)
KN416449 1 Kit

CCDC18 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF43 (NM_001256651) Human Tagged ORF Clone
RG239457 10 µg

ZNF43 (NM_001256651) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human ZNF720 activation kit by CRISPRa
GA114839 1 Kit

Human ZNF720 activation kit by CRISPRa

Sign In for Pricing
View Details
1-(2-Ethoxyphenyl)piperazine Monohydrochloride 99
TRC-E941100-5G 5 g

1-(2-Ethoxyphenyl)piperazine Monohydrochloride 99

Sign In for Pricing
View Details
Shaking Water Bath BBSW-4001
BBSW-4001 1 Unit

Shaking Water Bath BBSW-4001

Sign In for Pricing
View Details