What is the catalog number for NOXO1 Antibody - N-terminal region?

The catalog number for NOXO1 Antibody - N-terminal region is ARP90245_P050-25UL.

What sizes are available for NOXO1 Antibody - N-terminal region?

NOXO1 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is NOXO1 Antibody - N-terminal region in stock?

NOXO1 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

NOXO1 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

NADPH oxidase organizer 1

Gene Aliases

Hslt, Snx28, P41NOX, P41NOXA, P41NOXB, P41NOXC, 2310034C04Rik

Gene ID

71893

Swiss Prot

Q8VCM2-2

Accession Number

NP_082264.2

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse NOXO1

Target

Constitutively potentiates the superoxide-generating activity of NOX1 and NOX3 and is required for the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity. Isoform 3 is more potent than isoform 1 in activating NOX3. Together with NOXA1, may also substitute to NCF1/p47phox and NCF2/p67phox in supporting the phagocyte NOX2/gp91phox superoxide-generating activity.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VQMDRLQTFAFSVCWSDNSDTFVRRSWDEFRQLQKTLKKTFPVEAGLLRR

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol