Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pim2 Antibody Middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Proviral integration site 2

Gene Aliases

Pim, Pim-2, DXCch3

Gene ID

18715

Swiss Prot

Q62070

Accession Number

NP_613072.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse PIM2

Target

Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression, the regulation of cap-dependent protein translation and through survival signaling by phosphorylation of a pro-apoptotic protein, BAD. Phosphorylation of MYC leads to an increase of MYC protein stability and thereby an increase of transcriptional activity. The stabilization of MYC exerted by PIM2 might explain partly the strong synergism between these 2 oncogenes in tumorigenesis. Regulates cap-dependent protein translation in a mammalian target of rapamycin complex 1 (mTORC1) -independent manner and in parallel to the PI3K-Akt pathway. Mediates survival signaling through phosphorylation of BAD, which induces release of the anti-apoptotic protein Bcl-X (L) /BCL2L1. Promotes cell survival in response to a variety of proliferative signals via positive regulation of the I-kappa-B kinase/NF-kappa-B cascade; this process requires phosphorylation of MAP3K8/COT. Promotes growth factor-independent proliferation by phosphorylation of cell cycle factors such as CDKN1A and CDKN1B. Involved in the positive regulation of chondrocyte survival and autophagy in the epiphyseal growth plate.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHA

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

40 kDa

Protein Length

370

NCBI Gene Symbol

PIM2

Host or Source

Rabbit

Protein Name

Serine/threonine-protein kinase pim-2

Gene Name URL

PIM2

Nucleotide Accession Number

NM_138606.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Heat Shock Protein 90 (HSP90) ELISA Kit
YLA0079PO-01 48 Tests

Porcine Heat Shock Protein 90 (HSP90) ELISA Kit

Sign In for Pricing
View Details
Porcine Heat Shock Protein 90 (HSP90) ELISA Kit
YLA0079PO-02 96 Tests

Porcine Heat Shock Protein 90 (HSP90) ELISA Kit

Sign In for Pricing
View Details
IFluor® 840 Anti-human CD23 Antibody *EBVCS-5*
102300Q1-AAT 500 Tests

IFluor® 840 Anti-human CD23 Antibody *EBVCS-5*

Sign In for Pricing
View Details
KLKB1 Rabbit Polyclonal Antibody
53557-01 50 µL

KLKB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KLKB1 Rabbit Polyclonal Antibody
53557-02 100 µL

KLKB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XBP1 (X-Box Binding Protein 1, TREB5, XBP2) (MaxLight 550)
253475-ML550 100 µL

XBP1 (X-Box Binding Protein 1, TREB5, XBP2) (MaxLight 550)

Sign In for Pricing
View Details