Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR5A1 Antibody - middlel region

Product Specifications

CAS Number

9007-83-4

Gene Name

Nuclear receptor subfamily 5, group A, member 1

Gene Aliases

E, SF, Ad4, ELP, SF-, SF1, SF-1, Ad4BP, ELP-3, Ftzf1, STF-1, Ftz-F1

Gene ID

26423

Swiss Prot

P33242

Accession Number

NP_001303616.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse NR5A1

Target

Transcriptional activator. Seems to be essential for sexual differentiation and formation of the primary steroidogenic tissues. Binds to the Ad4 site found in the promoter region of steroidogenic P450 genes such as CYP11A, CYP11B and CYP21B. Also regulates the AMH/Muellerian inhibiting substance gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'-RRAGGTCA-3' are the consensus sequences for the recognition by NR5A1. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional activity (By similarity) . Transcription repressor of the Moloney leukemia virus long terminal repeat in undifferentiated murine embryonal carcinoma cells. Binds phosphatidylcholine and phospholipids with a phosphatidylinositol (PI) headgroup, in particular phosphatidyl (3,4) bisphosphate, phosphatidyl (3,5) bisphosphate and phosphatidyl (3,4,5) triphosphate. Activated by the phosphorylation of NR5A1 by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDR

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

50 kDa

Protein Length

462

NCBI Gene Symbol

NR5A1

Host or Source

Rabbit

Protein Name

Steroidogenic factor 1

Gene Name URL

NR5A1

Nucleotide Accession Number

NM_001316687.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GIPC3 Polyclonal Antibody
MF-0075297-01 50 µL

Anti-GIPC3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GIPC3 Polyclonal Antibody
MF-0075297-02 100 µL

Anti-GIPC3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GIPC3 Polyclonal Antibody
MF-0075297-03 200 µL

Anti-GIPC3 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Interleukin 33 Receptor (ST2) ELISA Kit
MBS9348955-01 48 Well

Rat Interleukin 33 Receptor (ST2) ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 33 Receptor (ST2) ELISA Kit
MBS9348955-02 96 Well

Rat Interleukin 33 Receptor (ST2) ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 33 Receptor (ST2) ELISA Kit
MBS9348955-03 5x 96 Well

Rat Interleukin 33 Receptor (ST2) ELISA Kit

Sign In for Pricing
View Details