Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELF3 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

E74-like factor 3

Gene Aliases

ES, je, ESX, jen, ESE-, ESE-1

Gene ID

13710

Swiss Prot

Q3UPW2

Accession Number

NP_001156603.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse ELF3

Target

Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter (By similarity) . Also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Represses KRT4 promoter activity (By similarity) . Involved in mediating vascular inflammation. May play an important role in epithelial cell differentiation and tumorigenesis. May be a critical downstream effector of the ERBB2 signaling pathway (By similarity) . May be associated with mammary gland development and involution. Plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRPRKLS

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

44 kDa

Protein Length

391

NCBI Gene Symbol

ELF3

Host or Source

Rabbit

Protein Name

ETS-related transcription factor Elf-3

Gene Name URL

ELF3

Nucleotide Accession Number

NM_001163131.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transcription Factor AP 2 gamma   monoclonal antibody
MB11919 50ul

Transcription Factor AP 2 gamma monoclonal antibody

Sign In for Pricing
View Details
CDC25 (Cell Division Cycle Protein 25, CDC25A, CDC25A2, M-phase inducer phosphatase 1)
362481 200 µL

CDC25 (Cell Division Cycle Protein 25, CDC25A, CDC25A2, M-phase inducer phosphatase 1)

Sign In for Pricing
View Details
MOBKL1A sgRNA CRISPR Lentivector set (Human)
K1314601 3x 1.0 µg

MOBKL1A sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Human LHX5 activation kit by CRISPRa
GA112013 1 Kit

Human LHX5 activation kit by CRISPRa

Sign In for Pricing
View Details
GNB1 (Guanine Nucleotide-Binding Protein G (I) /G (S) /G (T) Subunit Beta-1, Guanine Nucleotide Binding Protein (G Protein), Beta Polypeptide 1)
481979 100 µL

GNB1 (Guanine Nucleotide-Binding Protein G (I) /G (S) /G (T) Subunit Beta-1, Guanine Nucleotide Binding Protein (G Protein), Beta Polypeptide 1)

Sign In for Pricing
View Details
Mouse KIF26B shRNA Plasmid
abx983020-01 150 µg

Mouse KIF26B shRNA Plasmid

Sign In for Pricing
View Details