Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arg2 Antibody Middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Arginase type II

Gene Aliases

AII, AU022422

Gene ID

11847

Swiss Prot

O08691

Accession Number

NP_033835.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse ARG2

Target

May play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis. Extrahepatic arginase functions to regulate L-arginine bioavailability to nitric oxid synthase (NOS) . Arginine metabolism is a critical regulator of innate and adaptive immune responses. Seems to be involved in negative regulation of the survival capacity of activated CD4+ and CD8+ T cells. May suppress inflammation-related signaling in asthmatic airway epithelium. May contribute to the immune evasion of H.pylori by restricting M1 macrophage activation and polyamine metabolism. May play a role in promoting prenatal immune suppression (By similarity) . Regulates RPS6KB1 signaling, which promotes endothelial cell senescence and inflammation and implicates NOS3/eNOS dysfunction. Can inhibit endothelial autophagy independently of its enzymatic activity implicating mTORC2 signaling. Involved in vascular smooth muscle cell senescence and apoptosis independently of its enzymatic activity (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DAHADINTPLTTVSGNIHGQPLSFLIKELQDKVPQLPGFSWIKPCLSPPN

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

38 kDa

Protein Length

354

NCBI Gene Symbol

ARG2

Host or Source

Rabbit

Protein Name

Arginase-2, mitochondrial

Gene Name URL

ARG2

Nucleotide Accession Number

NM_009705.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HA, FITC-conjugated (chicken antibody)
AS20 4464 0.1 mg

Anti-HA, FITC-conjugated (chicken antibody)

Sign In for Pricing
View Details
Zfp566 Peptide - middle region
MBS3238656-01 0.1 mg

Zfp566 Peptide - middle region

Sign In for Pricing
View Details
Zfp566 Peptide - middle region
MBS3238656-02 5x 0.1 mg

Zfp566 Peptide - middle region

Sign In for Pricing
View Details
GOLGA6L2 (Golgin Subfamily A Member 6-like Protein 2, GOLGA6L2) (FITC) discontinued
302473-FITC 200 µL

GOLGA6L2 (Golgin Subfamily A Member 6-like Protein 2, GOLGA6L2) (FITC) discontinued

Sign In for Pricing
View Details
TPP2 Rabbit Polyclonal Antibody (Biotin)
orb2091082 100 µL

TPP2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
TSPYL1, CT (TSPYL1, TSPYL, Testis-specific Y-encoded-like protein 1) (MaxLight 650) discontinued
043388-ML650 100 µL

TSPYL1, CT (TSPYL1, TSPYL, Testis-specific Y-encoded-like protein 1) (MaxLight 650) discontinued

Sign In for Pricing
View Details