What is the catalog number for Rora Antibody Middle region?

The catalog number for Rora Antibody Middle region is ARP89398_P050.

What sizes are available for Rora Antibody Middle region?

Rora Antibody Middle region is available in the following size(s): 100 µL.

Is Rora Antibody Middle region in stock?

Rora Antibody Middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Rora Antibody Middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

RAR-related orphan receptor alpha

Gene Aliases

Sg, Nr1, ROR1, ROR2, ROR3, Nr1f1, nmf267, tmgc26, staggerer, 9530021D13Rik

Gene ID

19883

Swiss Prot

P51448

Accession Number

NP_001276845.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse RORA

Target

The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Three transcript variants encoding different isoforms have been found for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEA

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol