Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hnrnpa2b1 Antibody-C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Heterogeneous nuclear ribonucleoprotein A2/B1

Gene Aliases

Hn, Hnrp, Hnrpa2, hnrnp-A, Hnrpa2b1, 9130414A06Rik

Gene ID

53379

Swiss Prot

O88569-2

Accession Number

NP_058086.2

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse HNRNPA2B1

Target

Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs, packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging plays a role in various processes such as transcription, pre-mRNA processing, RNA nuclear export, subcellular location, mRNA translation and stability of mature mRNAs. Forms hnRNP particles with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Involved in transport of specific mRNAs to the cytoplasm in oligodendrocytes and neurons: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) or the A2RE11 (derivative 11 nucleotide oligonucleotide) sequence motifs present on some mRNAs, and promotes their transport to the cytoplasm (By similarity) . Specifically binds single-stranded telomeric DNA sequences, protecting telomeric DNA repeat against endonuclease digestion (By similarity) . Also binds other RNA molecules, such as primary miRNA (pri-miRNAs) : acts as a nuclear 'reader' of the N6-methyladenosine (m6A) mark by specifically recognizing and binding a subset of nuclear m6A-containing pri-miRNAs. Binding to m6A-containing pri-miRNAs promotes pri-miRNA processing by enhancing binding of DGCR8 to pri-miRNA transcripts. Involved in miRNA sorting into exosomes following sumoylation, possibly by binding (m6A) -containing pre-miRNAs. Acts as a regulator of efficiency of mRNA splicing, possibly by binding to m6A-containing pre-mRNAs (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGG

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

37 kDa

Protein Length

341

NCBI Gene Symbol

HNRNPA2B1

Host or Source

Rabbit

Protein Name

Hnrpa2, hnrnp-A, Hnrpa2b1, 9130414A06Rik

Gene Name URL

HNRNPA2B1

Nucleotide Accession Number

NM_016806.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-100 1x 100 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-500 1x 500 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-500 1x 500 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-100 1x 100 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-500 1x 500 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details