Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Isl1 Antibody-C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

ISL1 transcription factor, LIM/homeodomain

Gene ID

16392

Swiss Prot

P61372

Accession Number

NP_067434.3

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse ISL1

Target

DNA-binding transcriptional activator. Recognizes and binds to the consensus octamer binding site 5'-ATAATTAA-3' in promoter of target genes. Plays a fundamental role in the gene regulatory network essential for retinal ganglion cell (RGC) differentiation. Cooperates with the transcription factor POU4F2 to achieve maximal levels of expression of RGC target genes and RGC fate specification in the developing retina. Involved in the specification of motor neurons in cooperation with LHX3 and LDB1. Binds to insulin gene enhancer sequences (By similarity) . Essential for heart development. Marker of one progenitor cell population that give rise to the outflow tract, right ventricle, a subset of left ventricular cells, and a large number of atrial cells as well, its function is required for these progenitors to contribute to the heart. Controls the expression of FGF and BMP growth factors in this cell population and is required for proliferation and survival of cells within pharyngeal foregut endoderm and adjacent splanchnic mesoderm as well as for migration of cardiac progenitors into the heart.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PPWKVLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDT

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

38 kDa

Protein Length

349

NCBI Gene Symbol

ISL1

Host or Source

Rabbit

Protein Name

Insulin gene enhancer protein ISL-1

Gene Name URL

ISL1

Nucleotide Accession Number

NM_021459.4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CapZ-α1 CRISPR/Cas9 KO Plasmid (m)
sc-419446 20 µg

CapZ-α1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
DYLT1 Polyclonal Antibody
MBS8530007-01 0.1 mg

DYLT1 Polyclonal Antibody

Sign In for Pricing
View Details
DYLT1 Polyclonal Antibody
MBS8530007-02 0.1 mL (AF635)

DYLT1 Polyclonal Antibody

Sign In for Pricing
View Details
DYLT1 Polyclonal Antibody
MBS8530007-03 0.1 mL (AF610)

DYLT1 Polyclonal Antibody

Sign In for Pricing
View Details
DYLT1 Polyclonal Antibody
MBS8530007-04 0.1 mL (AF405S)

DYLT1 Polyclonal Antibody

Sign In for Pricing
View Details
DYLT1 Polyclonal Antibody
MBS8530007-05 0.1 mL (AF405L)

DYLT1 Polyclonal Antibody

Sign In for Pricing
View Details