Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aire Antibody-N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Autoimmune regulator (autoimmune polyendocrinopathy candidiasis ectodermal dystrophy)

Gene ID

11634

Swiss Prot

Q9Z0E3-6

Accession Number

NP_001258478.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse AIRE

Target

Transcription factor playing an essential role to promote self-tolerance in the thymus by regulating the expression of a wide array of self-antigens that have the commonality of being tissue-restricted in their expression pattern in the periphery, called tissue restricted antigens (TRA) (Probable) . Binds to G-doublets in an A/T-rich environment; the preferred motif is a tandem repeat of 5'-. ATTGGTTA-3' combined with a 5'-TTATTA-3' box. Binds to nucleosomes (By similarity) . Binds to chromatin and interacts selectively with histone H3 that is not methylated at 'Lys-4', not phosphorylated at 'Thr-3' and not methylated at 'Arg-2'. Functions as a sensor of histone H3 modifications that are important for the epigenetic regulation of gene expression. Mainly expressed by medullary thymic epithelial cells (mTECs), induces the expression of thousands of tissue-restricted proteins, which are presented on major histocompatibility complex class I (MHC-I) and MHC-II molecules to developing T-cells percolating through the thymic medulla (By similarity) . Also induces self-tolerance through other mechanisms such as the regulation of the mTEC differentiation program. Controls the medullary accumulation of thymic dendritic cells and the development of regulatory T-cell through the regulation of XCL1 expression. Regulates the production of CCR4 and CCR7 ligands in medullary thymic epithelial cells and alters the coordinated maturation and migration of thymocytes. In thimic B-cells, allows the presentation of licensing-dependent endogenous self-anitgen for negative selection. In secondary lymphoid organs, induces functional inactivation of CD4+ T-cells. Expressed by a distinct bone marrow-derived population, induces self-tolerance through a mechanism that does not require regulatory T-cells and is resitant to innate inflammatory stimuli .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GDGMLRRLLRLHRTEIAVAIDSAFPLLHALADHDVVPEDKFQETLRLKEK

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

54 kDa

Protein Length

492

NCBI Gene Symbol

AIRE

Host or Source

Rabbit

Protein Name

Autoimmune regulator

Gene Name URL

AIRE

Nucleotide Accession Number

NM_001271549.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MDR1/ABCB1 Antibody (MRK16) [Allophycocyanin]
NBP2-52701APC 0.1 mL

Mouse Monoclonal MDR1/ABCB1 Antibody (MRK16) [Allophycocyanin]

Sign In for Pricing
View Details
Rabbit Polyclonal Transducin alpha Antibody [DyLight 488]
NB120-3504G 0.1 mL

Rabbit Polyclonal Transducin alpha Antibody [DyLight 488]

Sign In for Pricing
View Details
Recombinant Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)
SIPA658Hu01-01 10 µg

Recombinant Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)

Sign In for Pricing
View Details
Recombinant Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)
SIPA658Hu01-02 50 µg

Recombinant Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)

Sign In for Pricing
View Details
Recombinant Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)
SIPA658Hu01-03 200 µg

Recombinant Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)

Sign In for Pricing
View Details
Recombinant Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)
SIPA658Hu01-04 1 mg

Recombinant Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)

Sign In for Pricing
View Details