Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anti-Ccr6

Product Specifications

CAS Number

9007-83-4

Gene Name

Chemokine (C-C motif) receptor 6

Gene Aliases

CCR-6, Cmkbr, KY411, Cmkbr6, CC-CKR-6

Gene ID

12458

Swiss Prot

O54689

Accession Number

NP_001177262.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse CCR6

Target

Receptor for the C-C type chemokine CCL20. Binds to CCL20 and subsequently transduces a signal by increasing the intracellular calcium ion levels. Although CCL20 is its major ligand it can also act as a receptor for non-chemokine ligands such as beta-defensins. Binds to defensin DEFB1 leading to increase in intracellular calcium ions and cAMP levels. Its binding to DEFB1 is essential for the function of DEFB1 in regulating sperm motility and bactericidal activity (By similarity) . Binds to defensins DEFB4 and DEFB4A/B and mediates their chemotactic effects. The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases. CCR6-mediated signals are essential for immune responses to microbes in the intestinal mucosa and in the modulation of inflammatory responses initiated by tissue insult and trauma. CCR6 is essential for the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for the normal migration of Th17 cells in Peyers patches and other related tissue sites of the intestine and plays a role in regulating effector T-cell balance and distribution in inflamed intestine. Plays an important role in the coordination of early thymocyte precursor migration events important for normal subsequent thymocyte precursor development, but is not required for the formation of normal thymic natural regulatory T-cells (nTregs) . Required for optimal differentiation of DN2 and DN3 thymocyte precursors. Essential for B-cell localization in the subepithelial dome of Peyers-patches and for efficient B-cell isotype switching to IgA in the Peyers-patches. Essential for appropriate anatomical distribution of memory B-cells in the spleen and for the secondary recall response of memory B-cells. Positively regulates sperm motility and chemotaxis via its binding to CCL20.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMP

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

42 kDa

Protein Length

367

NCBI Gene Symbol

CCR6

Host or Source

Rabbit

Protein Name

C-C chemokine receptor type 6

Gene Name URL

CCR6

Nucleotide Accession Number

NM_001190333.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Thrombomodulin/BDCA-3 Antibody (15C7)
NBP3-26288-100ul 100 µL

Rabbit Monoclonal Thrombomodulin/BDCA-3 Antibody (15C7)

Sign In for Pricing
View Details
pCMV-SPORT6-Mef2a Plasmid
PVT54869 2 µg

pCMV-SPORT6-Mef2a Plasmid

Sign In for Pricing
View Details
Human SLC30A3 activation kit by CRISPRa
GA105310 1 Kit

Human SLC30A3 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TIRAP Pre-designed siRNA Set B
SI016675B 1 Each

Human TIRAP Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit PVRL1/NECTIN1 Recombinant Monoclonal Antibody
orb1806452-01 20 ul

Rabbit PVRL1/NECTIN1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit PVRL1/NECTIN1 Recombinant Monoclonal Antibody
orb1806452-02 100 µL

Rabbit PVRL1/NECTIN1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details