Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hdac2 Antibody Middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Histone deacetylase 2

Gene Aliases

YAF1, Yy1b, Yy1bp, mRPD3, D10Wsu179, D10Wsu179e

Gene ID

15182

Swiss Prot

P70288

Accession Number

NP_032255.2

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle terminal region of mouse HDAC2

Target

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) . Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity) . Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRA

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

53 kDa

Protein Length

488

NCBI Gene Symbol

HDAC2

Host or Source

Rabbit

Protein Name

Histone deacetylase 2

Gene Name URL

HDAC2

Nucleotide Accession Number

NM_008229.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Tryptophan-2,3-dioxygenase (TDO)
TRV-0050675-01 20 µL

Monoclonal Antibody to Tryptophan-2,3-dioxygenase (TDO)

Sign In for Pricing
View Details
Monoclonal Antibody to Tryptophan-2,3-dioxygenase (TDO)
TRV-0050675-02 100 µL

Monoclonal Antibody to Tryptophan-2,3-dioxygenase (TDO)

Sign In for Pricing
View Details
Monoclonal Antibody to Tryptophan-2,3-dioxygenase (TDO)
TRV-0050675-03 200 µL

Monoclonal Antibody to Tryptophan-2,3-dioxygenase (TDO)

Sign In for Pricing
View Details
Monoclonal Antibody to Tryptophan-2,3-dioxygenase (TDO)
TRV-0050675-04 1 mL

Monoclonal Antibody to Tryptophan-2,3-dioxygenase (TDO)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Protein translocase subunit SecF (secF), partial
MBS7080826 Inquire

Recombinant Mycobacterium tuberculosis Protein translocase subunit SecF (secF), partial

Sign In for Pricing
View Details
Human PC (Protein Carbonyl) ELISA Kit
MBS7617889-01 48 Well

Human PC (Protein Carbonyl) ELISA Kit

Sign In for Pricing
View Details